PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001773-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 222aa    MW: 24522.3 Da    PI: 7.8883
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001773-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.2e-3247102359
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                      rY+eClkNhA+ +GghavDGCgEfm++ geegt +alkCaAC+CHRnFHR+e+e 
  NNU_001773-RA  47 VSRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALKCAACNCHRNFHRKETEG 102
                    579*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047708.1E-3049100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-294999IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2449101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.5945099IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.3E-32146221IPR009057Homeodomain-like
SuperFamilySSF466893.83E-20147220IPR009057Homeodomain-like
TIGRFAMsTIGR015655.0E-25159215IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEFDDHEEQD EEMGIPVSAT YDSLGNSARA KMASAAGDAA SSGRRTVSRY RECLKNHAVG  60
IGGHAVDGCG EFMAAGEEGT LDALKCAACN CHRNFHRKET EGDAYHHQFS PYYRTPAGYL  120
HVAPHHRPLA LPSTSGGGAH SREDQEDVSN PSGGGGVSKK RFRTKFTQEQ KDKMLAFAER  180
LGWRIQKHDE AAVQQFCTET CVKRHVLKVW MHNNKHTLGK KP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-291582171675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.11e-165PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ6YXH56e-91ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA5BZD71e-123A5BZD7_VITVI; Putative uncharacterized protein
TrEMBLF6H1061e-123F6H106_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-80homeobox protein 22